AV39623

Anti-CBLL1 antibody produced in rabbit

IgG fraction of antiserum

• 동의어(들): Anti-Cas-Br-M (murine) ecotropic retroviral transforming sequence-like 1
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: IgG fraction of antiserum
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 55 kDa
• 종 반응성: bovine, rat, human, mouse, horse, dog
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NP_079090
• UniProt 수납 번호: Q75N03
• 배송 상태: wet ice
• 저장 온도: −20°C
• 유전자 정보: human ... CBLL1(79872)

설명

일반 설명

CBLL1 (Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase) is a cbl-like ubiquitin ligase of E-cadherin complex. It is expressed in the neurons of central nervous system.
Rabbit Anti-CBLL1 antibody recognizes human, mouse, rat, zebrafish, canine, and chicken CBLL1.

면역원

Synthetic peptide directed towards the C terminal region of human CBLL1

애플리케이션

Rabbit Anti-CBLL1 antibody is suitable for western blot applications at a concentration of 1.25μg/ml.

생화학적/생리학적 작용

CBLL1 (Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase) is an E-cadherin binding protein involved in the ubiquitination of E-cadherin and regulation of E-cadherin complex endocytosis. During ubiquitination, it directly binds to the cytoplasmic domain of E-cadherin. It has been reported in a study that CBLL1 may play a role in neuronal apoptosis and in LPS (Lipopolysaccharide) administration. CBLL1 also have been predicted as a regulator of cell proliferation.

서열

Synthetic peptide located within the following region: PFTQPGGMSPGIWPAPRGPPPPPRLQGPPSQTPLPGPHHPDQTRYRPYYQ

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable