AV38234

Anti-SOX4 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-EVI16, Anti-SRY (sex determining region Y)-box 4
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 47 kDa
• 종 반응성: rabbit, rat, guinea pig, bovine, mouse, human, dog
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• NCBI 수납 번호: NP_003098
• UniProt 수납 번호: Q06945
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SOX4(6659)

설명

일반 설명

SRγ (sex determining region γ) (SOX) are HMG box containing transcription factors that bind to the minor groove of DNA. Sox proteins family members regulate a variety of aspects of development. SRγ (sex determining region γ)-box 4 (SOX4, EVI16, SRγ) is required for differentiation and proliferation in many tissues, including various cancers. Sox4 acts in part by stabilizing β-catenin. Sox4 is required for lymphocyte development. It is an early factor in B-cell differentiation.

SRY (sex determining region Y) (SOX) are high-mobility-group (HMG) box containing transcription factors, that binds to the minor groove of DNA. SRY box 4 (SOX4) is a member of the SOX family of transcription factors. It is expressed majorly in normal and neoplastic gut tissues. SOX4 gene is located on human chromosome 6p22.3.

특이성

Anti-SOX4 polyclonal antibody reacts with bovine, canine, human, mouse, rat, zebrafish, and chicken SRγ (sex determining region γ)-box 4 proteins.

면역원

Synthetic peptide directed towards the N terminal region of human SOX4

애플리케이션

Anti-SOX4 polyclonal antibody is used to tag SRγ (sex determining region γ)-box 4 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of SRγ (sex determining region γ)-box 4 in cell differentiation and proliferation, such as B-cell differentitation.

생화학적/생리학적 작용

SRY box 4 (SOX4) is required for differentiation and proliferation in many tissues, including various cancers. It stabilizes β-catenin. Sox4 is essential for lymphocyte development. It acts as an early factor in B-cell differentiation. SOX4 is involved in the regulation of embryonic development and the determination of cell fate. It acts as a transcriptional regulator after forming syndecan binding protein (syntenin), a protein complex. SOX4 modulates the apoptosis pathway, which leads to cell death and tumorigenesis. It regulates downstream effects of parathyroid hormone (PTH) and PTH-related protein (PTHrP) in bone development.

서열

Synthetic peptide located within the following region: STASTGGKADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNA

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 2
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable