콘텐츠로 건너뛰기
Merck
모든 사진(2)

주요 문서

AV34484

Sigma-Aldrich

Anti-SMARCA2 antibody produced in rabbit

affinity isolated antibody

로그인조직 및 계약 가격 보기


About This Item

MDL number:
UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

32 kDa

종 반응성

mouse, rabbit, horse, bovine, human, dog, guinea pig, rat

농도

0.5 mg - 1 mg/mL

기술

immunohistochemistry: suitable
western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... SMARCA2(6595)

관련 카테고리

일반 설명

SWItch/Sucrose Non-Fermentable (SWI/SNF)-related matrix-associated actin-dependent regulator of chromatin subfamily A member 2 (SMARCA2) is a member of the SWI/SNF family of proteins and is highly like the Brahma protein of Drosophila. Two transcript variants encoding different isoforms have been found for this gene, which contains a trinucleotide repeat (CAG) length polymorphism.

면역원

Synthetic peptide directed towards the middle region of human SMARCA2

애플리케이션

Rabbit Anti-SMARCA2 can be used for western blot applications at a concentration of 0.5 μg/ml. It can also be used for IHC applications at 4-8 μg/ml.

생화학적/생리학적 작용

SMARCA2 protein is a part of the large adenosine triphosphate (ATP)-dependent chromatin remodeling complex SWItch/sucrose non-fermentable (SWI/SNF), which is required for transcriptional activation of genes normally repressed by chromatin. Members of SWI/SNF family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes.

서열

Synthetic peptide located within the following region: VINYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKY

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Minori Koga et al.
Human molecular genetics, 18(13), 2483-2494 (2009-04-14)
Chromatin remodeling may play a role in the neurobiology of schizophrenia and the process, therefore, may be considered as a therapeutic target. The SMARCA2 gene encodes BRM in the SWI/SNF chromatin-remodeling complex, and associations of single nucleotide polymorphisms (SNPs) to
Jeroen K J Van Houdt et al.
Nature genetics, 44(4), 445-449 (2012-03-01)
Nicolaides-Baraitser syndrome (NBS) is characterized by sparse hair, distinctive facial morphology, distal-limb anomalies and intellectual disability. We sequenced the exomes of ten individuals with NBS and identified heterozygous variants in SMARCA2 in eight of them. Extended molecular screening identified nonsynonymous

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.