추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
IgG fraction of antiserum
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
67 kDa
종 반응성
horse, human, bovine, rat, dog, pig
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... PIAS3(10401)
일반 설명
PIAS3 is a transcription factor that facilitates protein SUMOylation. It inhibits STAT3-mediated signaling and studies have reported that its overexpression can induce apoptosis in prostate cancer cells. PIAS3 can also function as a biomarker for human cancer.
Rabbit Anti-PIAS3 antibody recognizes human, rat, canine, mouse, and bovine PIAS3.
Rabbit Anti-PIAS3 antibody recognizes human, rat, canine, mouse, and bovine PIAS3.
면역원
Synthetic peptide directed towards the C terminal region of human PIAS3
애플리케이션
Rabbit Anti-PIAS3 antibody can be used for western blot (1.0-2.0 μg/ml) and IHC (4-8 μg/ml) applications.
생화학적/생리학적 작용
PIAS3 is a member of the protein inhibitor of activated STAT (PIAS) family. It also activates TGF-beta/SMAD transcriptional responses.
서열
Synthetic peptide located within the following region: TSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIV
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Liming Wang et al.
Oncology reports, 11(6), 1319-1324 (2004-05-13)
STAT3 mediated signaling pathways can be inhibited by PIAS3 (protein inhibitor of activated STAT3), which was recently found to regulate protein stability and function by its SUMO (small-ubiquitin like modifiers) ligase activity in promoting sumoylation of important nuclear proteins. Over-expression
Down-regulation of ATBF1 activates STAT3 signaling via PIAS3 in pacing-induced HL-1 atrial myocytes.
Qi Jiang et al.
Biochemical and biophysical research communications, 449(3), 278-283 (2014-05-27)
Atrial fibrillation (AF) is progressive and is the most common clinical arrhythmia. It is associated with inflammatory changes characterized by signal transducer and activator of transcription 3 (STAT3) signaling. A zinc finger homeobox 3 (ZFHX3, also named AT-motif binding factor
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.