추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
IgG fraction of antiserum
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
81 kDa
종 반응성
rat, human, dog, mouse, bovine, horse
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... MTF1(4520)
관련 카테고리
일반 설명
Metal-response element-binding transcription factor 1 (MTF1) is a cellular zinc sensor that is involved in zinc homeostasis. MTF1 is also known to protect against oxidative stress and metal toxicity. Furthermore, MTF1 can modulate metallothionein gene expression.
Rabbit Anti-MTF1 antibody recognizes human, mouse, rat, bovine, and canine MTF1.
Rabbit Anti-MTF1 antibody recognizes human, mouse, rat, bovine, and canine MTF1.
면역원
Synthetic peptide directed towards the C terminal region of human MTF1
애플리케이션
Rabbit Anti-MTF1 antibody can be used for western blot applications at a concentration of 5.0μg/ml.
생화학적/생리학적 작용
The zinc finger transcription factor MTF-1 (metal-responsive transcription factor-1) is conserved from insects to vertebrates. The major role of MTF-1 in both organisms is to control the transcription of genes involved in the homeostasis and detoxification of heavy metal ions such as Cu2+, Zn2+ and Cd2+. In mammals, MTF-1 serves at least two additional roles. First, targeted disruption of the MTF-1 gene results in death at embryonic day 14 due to liver degeneration, revealing a stage-specific developmental role. Second, under hypoxic-anoxic stress, MTF-1 helps to activate the transcription of the gene placental growth factor (PIGF), an angiogenic protein.
서열
Synthetic peptide located within the following region: QSSLVMGEQNLQWILNGATSSPQNQEQIQQASKVEKVFFTTAVPVASSPG
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Biometals : an international journal on the role of metal ions in biology, biochemistry, and medicine, 14(3-4), 223-237 (2002-02-08)
Zinc metabolism in higher eukaryotes is complex, being controlled by uptake, efflux, and storage in individual cells, as well as in peripheral tissues and organs. Recently there have been advances in the understanding of the genes involved in these processes
The EMBO journal, 13(12), 2870-2875 (1994-06-15)
We have described and cloned previously a factor (MTF-1) that binds specifically to heavy metal-responsive DNA sequence elements in the enhancer/promoter region of metallothionein genes. MTF-1 is a protein of 72.5 kDa that contains six zinc fingers and multiple domains
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.