추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
63 kDa
종 반응성
rabbit, human
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... NPAS1(4861)
일반 설명
NPAS1 is a basic helix-loop-helix transcription factor that that regulates branching morphogenesis in mouse embryonic lung tissues. Studies in mice have reported that NPAS1 deficiency can result in behavioural and functional abnormalities.
Rabbit Anti-NPAS1 antibody recognizes human, mouse, and rat NPAS1.
Rabbit Anti-NPAS1 antibody recognizes human, mouse, and rat NPAS1.
면역원
Synthetic peptide directed towards the C terminal region of human NPAS1
애플리케이션
Rabbit Anti-NPAS1 antibody can be used for western blotting at 2μg/ml. It can also be used for IHC at 4-8μg/ml, using paraffin-embedded tissues.
생화학적/생리학적 작용
NPAS1 is a member of the basic helix-loop-helix (bHLH)-PAS family of transcription factors. Studies of a related mouse gene suggest that it functions in neurons. The exact function of this gene is unclear, but it may play protective or modulatory roles during late embryogenesis and postnatal development.
서열
Synthetic peptide located within the following region: TIRYGPAELGLVYPHLQRLGPGPALPEAFYPPLGLPYPGPAGTRLPRKGD
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Bernadette M Levesque et al.
American journal of respiratory cell and molecular biology, 36(4), 427-434 (2006-11-18)
Drosophila trachealess (Trl), master regulator of tracheogenesis, has no known functional mammalian homolog. We hypothesized that genes similar to trachealess regulate lung development. Quantitative (Q)RT-PCR and immunostaining were used to determine spatial and temporal patterns of npas1 gene expression in
Claudia Erbel-Sieler et al.
Proceedings of the National Academy of Sciences of the United States of America, 101(37), 13648-13653 (2004-09-07)
Laboratory mice bearing inactivating mutations in the genes encoding the NPAS1 and NPAS3 transcription factors have been shown to exhibit a spectrum of behavioral and neurochemical abnormalities. Behavioral abnormalities included diminished startle response, as measured by prepulse inhibition, and impaired
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.