AV31648

Anti-LASS3 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-LAG1 homolog, ceramide synthase 3 (S. cerevisiae)
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 46 kDa
• 종 반응성: human
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NP_849164
• UniProt 수납 번호: Q8IU89
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... LASS3(204219)

설명

일반 설명

Longevity assurance homologue 3 (LASS3) is a testis-specific (dihyrdo)ceramide synthase that acts on a broad range of substrates. LASS3 is known to have two transcriptional variants, comprising of a 384-amino acid protein and a 419-amino acid protein.
Rabbit Anti-LASS3 antibody recognizes zebrafish, chicken, human, mouse, rat, bovine, and canine LASS3.

면역원

Synthetic peptide directed towards the N terminal region of human LASS3

애플리케이션

Rabbit Anti-LASS3 antibody can be used for western blot applications at a concentration of 0.5μg/ml.

생화학적/생리학적 작용

The gene encoding the hypothetical protein LASS3 is located on chromosome 15.

서열

Synthetic peptide located within the following region: RVFEKFVASPLAKSFGIKETVRKVTPNTVLENFFKHSTRQPLQTDIYGLA

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable