콘텐츠로 건너뛰기
Merck
모든 사진(1)

주요 문서

AV09053

Sigma-Aldrich

Anti-SFRP1 antibody produced in rabbit

IgG fraction of antiserum

동의어(들):

Anti-Secreted frizzled-related protein 1

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

IgG fraction of antiserum

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

35 kDa

종 반응성

mouse, human, guinea pig, horse, dog, rat

농도

0.5 mg - 1 mg/mL

기술

western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... SFRP1(6422)

관련 카테고리

면역원

Synthetic peptide directed towards the middle region of human SFRP1

애플리케이션

Anti-SFRP1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.3 μg/ml.

생화학적/생리학적 작용

Secreted Frizzled-related protein 1 (SFRP1) is a secreted antagonist of Wnt signaling pathway. It is secreted in excess amounts during DNA damage- or oxidative stress-induced cellular senescence. SFRP1 is a modulator of normal and malignant hematopoiesis and cell proliferation. Gene polymorphisms, aberrations and methylation of SFRP1 is a feature in bladder cancers resulting in excessive activation of Wnt pathway.

서열

Synthetic peptide located within the following region: HQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPT

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Anja Rogler et al.
International journal of clinical and experimental pathology, 6(10), 1984-1998 (2013-10-18)
In this study, we determined the genotype distribution of two single nucleotide polymorphisms (SNPs) in secreted frizzled related protein 1 (SFRP1), rs3242 and rs921142, in a Caucasian bladder cancer case-control study. Allelic variants of the SNPs were determined using restriction
Chi Keung Cheng et al.
Blood, 118(25), 6638-6648 (2011-10-28)
Secreted-frizzled related proteins (SFRPs) are modulators of the Wnt signaling pathway that is closely involved in normal and malignant hematopoiesis. Epigenetic deregulation of Wnt modulators leading to aberrant signaling has been reported in adult patients with acute myeloid leukemia (AML)
Yange Wang et al.
Frontiers in cellular and infection microbiology, 10, 101-101 (2020-04-02)
Schistosomiasis remains a serious parasitic disease, which is characterized by granulomatous inflammation and hepatic fibrosis. MicroRNAs derived from parasites can regulate host genes and cell phenotype. Here, we showed that a miRNA derived from S. japonicum (Sja-miR-1) exists in the
Xiaobin Wang et al.
Oncology letters, 4(2), 334-338 (2012-07-31)
The aims of this study were to determine the methylation and expression status of secreted Frizzled-related protein 1 (SFRP1) in bladder cancer, to explore the mechanisms involved and to study the role of SFRP1 in the pathogenesis of bladder cancer.
David J Elzi et al.
Molecular and cellular biology, 32(21), 4388-4399 (2012-08-29)
Cellular senescence has emerged as a critical tumor suppressive mechanism in recent years, but relatively little is known about how senescence occurs. Here, we report that secreted Frizzled-related protein 1 (SFRP1), a secreted antagonist of Wnt signaling, is oversecreted upon

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.