추천 제품
![Anti-OCT-4 [POU5F1] Antibody, clone 7F9.2 clone 7F9.2, from mouse](/deepweb/assets/sigmaaldrich/product/images/307/874/7354f72d-80ee-40a5-b7fa-0590fe6784cc/640/7354f72d-80ee-40a5-b7fa-0590fe6784cc.jpg)
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
IgG fraction of antiserum
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
11 kDa
종 반응성
human
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... CXCL3(2921)
면역원
Synthetic peptide directed towards the middle region of human CXCL3
애플리케이션
Anti-CXCL3 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
생화학적/생리학적 작용
CXCL3 is a chemokine that binds to CXCR1 and CXCR2 receptors and stimulates p38 and ERK1/2-dependent migration of asthmatic airway smooth muscle cells. Prostate stromal cells secrete CXCL3 in response to IL-1 that results in prostatic inflammation in early stages of prostate cancer formation.
표적 설명
CXCL3 is a chemokine that affects migration and adhesion of monocytes. CXCR2 is its known receptor.
서열
Synthetic peptide located within the following region: QSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Ya-Ling Qi et al.
Journal of cellular physiology, 235(5), 4756-4765 (2019-11-02)
CXCL3 belongs to the CXC-type chemokine family and is known to play a multifaceted role in various human malignancies. While its clinical significance and mechanisms of action in uterine cervical cancer (UCC) remain unclear. This investigation demonstrated that the UCC
Arpita S Bharadwaj et al.
Ocular immunology and inflammation, 25(6), 811-819 (2016-07-06)
B cells participate in diverse retinal immunopathologies. Endothelial adhesion molecules and chemokines direct leukocyte trafficking. We examined the involvement of three molecular signals in retinal transendothelial migration of human B cells: ICAM-1, VCAM-1, and CXCL13. Peripheral blood B cells were
Guo-Tian Ruan et al.
Oncology reports, 42(5), 1996-2008 (2019-09-24)
The diagnostic and prognostic mechanisms of C‑X‑C motif chemokine ligand 3 (CXCL3) in colon cancer (CC) have not yet been reported. Therefore, the objective of the present study was to use cohorts of patients from Guangxi Medical University and the
Ira Kogan-Sakin et al.
Carcinogenesis, 30(4), 698-705 (2009-02-24)
It is well accepted that tumor microenvironment is essential for tumor cells survival, cancer progression and metastasis. However, the mechanisms by which tumor cells interact with their surrounding at early stages of cancer development are largely unidentified. The aim of
Laila A Al-Alwan et al.
Journal of immunology (Baltimore, Md. : 1950), 191(5), 2731-2741 (2013-08-02)
Structural cell migration plays a central role in the pathophysiology of several diseases, including asthma. Previously, we established that IL-17-induced (CXCL1, CXCL2, and CXCL3) production promoted airway smooth muscle cell (ASMC) migration, and consequently we sought to investigate the molecular
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.