AMAB91799

Anti-TFE3 antibody produced in mouse

Prestige Antibodies^® Powered by Atlas Antibodies, clone CL12822, purified by using Protein A, buffered aqueous glycerol solution

• 동의어(들): bHLHe33,TFEA
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 생산 유형: primary antibodies
• 클론: CL12822, monoclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 형태: buffered aqueous glycerol solution
• 정제법: using Protein A
• 종 반응성: human
• 기술: immunofluorescence: 2-10 μg/mL; immunohistochemistry: 1:1000-1:2500; western blot: 1 μg/mL
• 동형: IgG1
• Ensembl | 인체 수납 번호: ENSG00000068323
• 배송 상태: wet ice
• 저장 온도: −20°C
• 유전자 정보: human ... TFE3(7030)

설명

면역원

Transcription factor binding to ighm enhancer 3

애플리케이션

All Prestige Antibodies^® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

특징 및 장점

All Prestige Antibodies^® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

서열

SKDLESRQRSLEQANRSLQLRIQELELQAQIHGLPVPPTPGLLSLATTSASDSLKPEQLDIEEEGRPGAATFHVGGGPAQNAPHQQPPAPPSDALLDLHFPSDHLGDLGDPFHLGLEDILMEEEEGVVGGLSGGALSPLRAAS

결합

Corresponding Antigen APREST76155

물리적 형태

The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

저장 및 안정성

Store at +4°C for short term storage. Long time storage is recommended at -20°C.

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1