Skip to Content
Merck
All Photos(4)

Key Documents

Safety Information

WH0117581M1

Sigma-Aldrich

Monoclonal Anti-TWIST2 antibody produced in mouse

clone 3C8, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-DERMO1, Anti-MGC117334, Anti-twist homolog 2 (Drosophila)

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3C8, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

application(s)

research pathology

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TWIST2(117581)

General description

Twist family bHLH transcription factor 2 (TWIST2) is part of the basic helix-loop-helix protein (bHLH) family. It acts as a molecular switch by activating or repressing target genes. The TWIST2 gene is localized on human chromosome 2q37.3.

Immunogen

TWIST2 (AAH33168, 1 a.a. ~ 160 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGSWSMSASH

Application

Monoclonal Anti-TWIST2 antibody produced in mouse has been used in immunohistochemistry.

Biochem/physiol Actions

Twist family bHLH transcription factor 2 (TWIST2) modulates transcription in mesenchymal cell lineages during development. It interacts with E-protein modulators and binds with E-box on DNA sequences. Mutations in the TWIST2 gene have been linked with Setleis syndrome.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

nwg

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Listings

Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.

JAN Code

WH0117581M1-100UG:


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Biological function and molecular mechanism of Twist2.
Chengxiao Z and Ze Y
Yi Chuan = Hereditas / Zhongguo yi Chuan Xue Hui Bian ji, 37(1), 17-24 (2015)
Clinical Description, Molecular Analysis of TWIST2 Gene, and Surgical Treatment in a Patient With Barber-Say Syndrome.
Zuazo F
Ophthalmic Plastic and Reconstructive Surgery (2018)
Coexpression of Bcl-2 with epithelial?mesenchymal transition regulators is a prognostic indicator in hepatocellular carcinoma
Nan Zhao
Medical Oncology (Northwood, London, England) (2012)
Masanori Murakami et al.
Development, growth & differentiation, 50(2), 121-130 (2008-01-24)
Transforming growth factor-beta (TGF-beta) has been demonstrated to inhibit myogenesis in myoblasts. Here we report that transcriptional upregulation of p21(WAF1/Cip1) and muscle creatinine kinase (MCK) genes in C2C12 cells, which are associated with growth arrest at the G1 phase and

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service