Skip to Content
Merck
All Photos(8)

Documents

Safety Information

WH0004869M1

Sigma-Aldrich

Monoclonal Anti-NPM1 antibody produced in mouse

clone 3B2, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-B23, Anti-NPM, Anti-nucleophosmin (nucleolar phosphoprotein B23, numatrin)

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3B2, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

ELISA: suitable
immunofluorescence: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

application(s)

research pathology

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... NPM1(4869)

General description

NPM1 is a ubiquitously expressed nucleolar protein that shuttles between the nucleus and cytoplasm. It is implicated in multiple functions, including ribosomal protein assembly and transport, control of centrosome duplication, and regulation of the tumor suppressor ARF (MIM 600160). NPM1 mutations that relocalize NPM1 from the nucleus into the cytoplasm are associated with development of acute myeloid leukemia (AML; MIM 601626) (Garzon et al., 2008 [PubMed 18308931]). This gene is located on human chromosome 5q35.
NPM1 is a ubiquitously expressed nucleolar protein that shuttles between the nucleus and cytoplasm. It is implicated in multiple functions, including ribosomal protein assembly and transport, control of centrosome duplication, and regulation of the tumor suppressor ARF (MIM 600160). NPM1 mutations that relocalize NPM1 from the nucleus into the cytoplasm are associated with development of acute myeloid leukemia (AML; MIM 601626) (Garzon et al., 2008 [PubMed 18308931]).[supplied by OMIM]
Nucleophosmin 1 (NPM1) is an important multifunctional protein mainly located in the nucleolus. This gene is located on human chromosome 5q35.

Immunogen

NPM1 (AAH02398.1, 1 a.a. ~ 294 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Application

Monoclonal Anti-NPM1 antibody produced in mouse has been used in immunoblotting.
The antibody may be used for ELISA, competitive ELISA, immunoblotting (37 kDa), immunoprecipitation, immunohistochemistry, immunocytochemistry (2% formaldehyde-acetone 1,2,5 or 10% formalin/methanol-1% NP-40 and microinjection (blocks the initiation of centrosome duplication). Reactivity has been observed with human, monkey, bovine, dog, hamster (weak), rat,kangaroo rat, and mouse B23.

Biochem/physiol Actions

NPM1 (nucleophosmin 1) induces cell proliferation. It increases migration and invasion of cells.
NPM1 (nucleophosmin 1) induces cell proliferation. It increases migration and invasion of cells. Mutations in NPM1 result in acute myeloid leukemia (AML).

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Listings

Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.

JAN Code

WH0004869M1-100UG:


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

NPM1 Deletion Is Associated with Gross Chromosomal Rearrangements in Leukemia.
Starza RL, et al.
PLoS ONE, 5(9), e12855-e12855 (2010)
The linker histone H1. 2 is a novel component of the nucleolar organizer regions
Junjie C, et al.
The Journal of Biological Chemistry, M117-M117 (2018)
Overexpression and Nucleolar Localization of γ-Tubulin Small Complex Proteins GCP2 and GCP3 in Glioblastoma.
Draberova E, et al.
Journal of Neuropathology and Experimental Neurology, 74(7), 723?742-723?742 (2015)
Enhanced levels of double-strand DNA break repair proteins protect ovarian cancer cells against genotoxic stress-induced apoptosis.
Kalra RS and Bapat SA
Journal of Ovarian Research, 6(1), 66-66 (2013)
Dynamic localization of alpha-tubulin acetyltransferase ATAT1 through the cell cycle in human fibroblastic KD cells
Nekooki-Machida, et al.
Medical Molecular Morphology, 1-10 (2018)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service