Skip to Content
Merck
All Photos(2)

Key Documents

Safety Information

SAB1403512

Sigma-Aldrich

Monoclonal Anti-MUC5B antibody produced in mouse

clone 8C11, ascites fluid

Synonym(s):

MG1, MUC5, MUC9

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

ascites fluid

antibody product type

primary antibodies

clone

8C11, monoclonal

mol wt

antigen ~38.21 kDa

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1:500-1:1000

isotype

IgG2aκ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... MUC5B(727897)

Related Categories

General description

Mucin 5B (MUC5B) is a high molecular mass, heavily O-glycosylated gel-forming mucin. It is encoded by the gene mapped to human chromosome 11p15.5. MUC5B is found in bronchus glands, submaxillary glands, endocervix, gall bladder, and pancreas.

Immunogen

MUC5B (XP_039877.9, 4186 a.a. ~ 4295 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
CEEDSCQVRINTTILWHQGCETEVNITFCEGSCPGASKYSAEAQAMQHQCTCCQERRVHEETVPLHCPNGSAILHTYTHVDECGCTPFCVPAPMAPPHTRGFPAQEATAV

Application

Monoclonal Anti-MUC5B antibody produced in mouse has been used in immunofluorescence .

Biochem/physiol Actions

MUC5B is salivary mucin that might contribute to the lubrication, hydration, pathogen exclusion, and viscoelastic properties of the whole saliva. The protein acts as a marker of mucous gland cells. Mouse MUC5B plays a vital role in maintaining immune homeostasis in the lungs. It is also involved in preventing infections in the airways and middle ear by facilitating mucociliary clearance (MCC). Mutation in the MUC5B gene leads to the development of idiopathic pulmonary fibrosis. Overexpression of the gene stimulates aggressive behavior of breast cancer MCF7 cells.

Physical form

Clear solution

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

11 - Combustible Solids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Regulatory Listings

Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.

JAN Code

SAB1403512-200UL:


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Hélène Valque et al.
PloS one, 7(10), e46699-e46699 (2012-10-12)
The mucin MUC5B has a critical protective function in the normal lung, salivary glands, esophagus, and gallbladder, and has been reported to be aberrantly expressed in breast cancer, the second leading cause of cancer-related deaths among women worldwide. To understand
Shinji Sumiyoshi et al.
Lung cancer (Amsterdam, Netherlands), 84(3), 281-288 (2014-04-15)
The characteristics of non-terminal respiratory unit (TRU) type lung adenocarcinoma are still unclear. The aim of the present study was to characterize non-TRU type lung adenocarcinoma. We analyzed the expression of mucins MUC5B and MUC5AC, as well as thyroid transcription
Grant E Duclos et al.
Science advances, 5(12), eaaw3413-eaaw3413 (2019-12-18)
The human bronchial epithelium is composed of multiple distinct cell types that cooperate to defend against environmental insults. While studies have shown that smoking alters bronchial epithelial function and morphology, its precise effects on specific cell types and overall tissue
Lina M Salazar-Peláez et al.
PloS one, 10(3), e0119717-e0119717 (2015-03-15)
Vitronectin, a multifunctional glycoprotein, is involved in coagulation, inhibition of the formation of the membrane attack complex (MAC), cell adhesion and migration, wound healing, and tissue remodeling. The primary cellular source of vitronectin is hepatocytes; it is not known whether
Heather S Davies et al.
PloS one, 9(9), e108372-e108372 (2014-09-30)
The salivary mucins that include MUC5B (gel-forming) and MUC7 (non-gel-forming) are major contributors to the protective mucus barrier in the oral cavity, and it is possible that dietary components may influence barrier properties. We show how one dietary compound, the

Global Trade Item Number

SKUGTIN
SAB1403512-200UL4061838057310

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service