Skip to Content
Merck
All Photos(2)

Key Documents

Safety Information

AV51212

Sigma-Aldrich

Anti-C3ORF10 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-HSPC300, Anti-MDS027, Anti-hHBrk1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

9 kDa

species reactivity

rat, dog, bovine, pig, horse, human, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... C3orf10(55845)

Immunogen

Synthetic peptide directed towards the middle region of human C3orf10

Application

Anti-C3ORF10 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Biochem/physiol Actions

C3ORF10 (HSPC300) is a protein associated with the organization of actin filaments and cell motility. It interacts with WAVE2 protein and affects the metastatic potential of lung squamous cell carcinoma. Loss of the actin regulation by HSPC300 confers resistance to clear cell renal cell carcinoma in Von Hippel-Lindau patients indicating its role in tumor progression.

Sequence

Synthetic peptide located within the following region: YIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Regulatory Listings

Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.

JAN Code

AV51212-100UG:
AV51212-100UL:


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Xiongwei Cai et al.
Lung cancer (Amsterdam, Netherlands), 65(3), 299-305 (2009-07-07)
The small protein, HSPC300 (haematopoietic stem/progenitor cell protein 300), is associated with reorganization of actin filaments and cell movement, but its activity has not been reported in human cancer cells. Here, we investigated the association of HSPC300 expression with clinical
Alberto Cascón et al.
Human mutation, 28(6), 613-621 (2007-02-22)
Clear cell renal cell carcinoma (ccRCC) is the most common malignant neoplasm of the kidney. The majority of hereditary and sporadic ccRCC cases are associated with germline and somatic mutations in the Von Hippel-Lindau gene (VHL), respectively. Gross deletions at

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service