Skip to Content
Merck
All Photos(2)

Key Documents

Safety Information

AV44434

Sigma-Aldrich

Anti-FMO3 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-FMOII, Anti-Flavin containing monooxygenase 3, Anti-MGC34400, Anti-dJ127D3.1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

59 kDa

species reactivity

bovine, rat, human, pig, dog

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... FMO3(2328)

Immunogen

Synthetic peptide directed towards the N terminal region of human FMO3

Application

Anti- FMO3 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.

Biochem/physiol Actions

FMO3 belongs to the Flavin-containing monooxygenases (FMO) family of drug-metabolizing enzymes that catalyze the oxidation of various xenobiotics. FMO3 is a transmembrane protein present in the endoplasmic reticulum. Mutations in gene encoding FMO3 causes trimethylaminuria or fish odor syndrome.

Sequence

Synthetic peptide located within the following region: FMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFATTGQWDVTTE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Regulatory Listings

Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.

JAN Code

AV44434-100UL:
AV44434-50UG:


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Filipa Ferreira et al.
Gene, 527(1), 366-370 (2013-06-25)
Trimethylaminuria (TMAu) or "fish odor syndrome" is a metabolic disorder characterized by the inability to convert malodorous dietarily-derived trimethylamine (TMA) to odorless TMA N-oxide by the flavin-containing monooxygenase 3 (FMO3). Affected individuals unable to complete this reaction exude a "fishy"
Catherine A Ulman et al.
Dermatology online journal, 20(1), 21260-21260 (2014-01-25)
Trimethylaminuria is a rare, autosomal recessive, metabolic disorder that results in accumulation of trimethylamine (TMA), which smells like rotten fish. The chemical is excreted in sweat and urine owing to a deficiency in the enzyme flavin monooxygenase 3 (FMO3). We
Hiroshi Yamazaki et al.
Biochemical pharmacology, 85(11), 1588-1593 (2013-04-10)
Human flavin-containing monooxygenase 3 (FMO3, EC 1.14.13.8) in liver catalyzes a variety of oxygenations of nitrogen- and sulfur-containing medicines and xenobiotic substances. Loss-of-function mutations of the FMO3 gene, the enzyme responsible for trimethylamine N-oxygenation, cause the inherited disorder trimethylaminuria (also

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service