WH0006623M1

Monoclonal Anti-SNCG antibody produced in mouse

clone 2C3, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-BCSG1, Anti-SR, Anti-synuclein, gamma (breast cancer-specific protein 1)
• Numero MDL: MFCD02097426
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 2C3, monoclonal
• Stato: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• N° accesso Genebanck: BC014098
• N° accesso UniProt: O76070
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... SNCG(6623)

Descrizione

Descrizione generale

Synuclein gamma (SNCG) gene encodes a member of the synuclein family of proteins which are believed to be involved in the pathogenesis of neurodegenerative diseases. Mutations in this gene have also been associated with breast tumor development. (provided by RefSeq).
Synuclein gamma (SNCG) is a breast cancer specific gene. SNCG is highly expressed in malignant cancer cells and neuronal cells. SNCG gene is located on human chromosome 10q23.2. SNCG is a member of the brain protein synuclein family.

Immunogeno

SNCG (AAH14098, 21 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD

Applicazioni

Monoclonal Anti-SNCG antibody produced in mouse has been used in western blotting.

Azioni biochim/fisiol

Synuclein gamma (SNCG) induces migration, invasion and metastasis of tumor cells. It promotes the migration of human breast adenocarcinoma cell line (MCF7) by activating extracellular-signal regulated kinase (Erk) pathway and disrupting cell-cell junctions. SNCG is associated with breast or ovarian cancer progression. Urine SNCG is used as a prognostic biomarker for bladder cancer.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)