Passa al contenuto
Merck
Tutte le immagini(6)

Key Documents

WH0006241M1

Sigma-Aldrich

Monoclonal Anti-RRM2 antibody produced in mouse

clone 1E1, purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

Rrm2 Antibody, Rrm2 Antibody - Monoclonal Anti-RRM2 antibody produced in mouse, Anti-R2, Anti-RR2M, Anti-ribonucleotide reductase M2 polypeptide

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(6)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

mouse

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

1E1, monoclonal

Forma fisica

buffered aqueous solution

Reattività contro le specie

human

tecniche

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
immunoprecipitation (IP): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

Isotipo

IgG1κ

N° accesso Genebanck

NM_001034

N° accesso UniProt

P31350

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... RRM2(6241)

Categorie correlate

Descrizione generale

The ribonucleotide reductase regulatory subunit M2 (RRM2) gene is located on the human chromosome at 2p25.1. RRM2 protein is a component of ribonucleotide reductase (RR). This protein is a dimer and each dimer consists of tyrosine free-radical and non-heme iron.

Immunogeno

RRM2 (NP_001025, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLS

Applicazioni

Monoclonal Anti-RRM2 antibody produced in mouse has been used in:
  • immunohistochemistry
  • western blotting
  • immunofluorescence

Azioni biochim/fisiol

Ribonucleotide reductase regulatory subunit M2 (RRM2) protein regulates the activity of ribonucleotide reductase (RR) during the G1/early S phase of the cell cycle when DNA replication takes place. This protein provides the essential precursors for DNA synthesis. RRM2 protein catalyzes the biogenesis of deoxyribonucleotides from their corresponding ribonucleotides. RRM2 protein acts as a biomarker for various human cancers. Overexpression of RRM2 gene is observed during tumor progression, cellular response to DNA damage and increased cellular invasiveness.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

RRM2 induces NF-kappaB-dependent MMP-9 activation and enhances cellular invasiveness
Duxbury M S and Whang E E
Biochemical and biophysical research communications, 354(1), 190-196 (2007)
Systemic delivery of siRNA nanoparticles targeting RRM2 suppresses head and neck tumor growth
Rahman M A, et al.
Journal of Controlled Release : Official Journal of the Controlled Release Society, 159(3), 384-392 (2012)
Potent siRNA inhibitors of ribonucleotide reductase subunit RRM2 reduce cell proliferation in vitro and in vivo
Heidel J D, et al.
Current Rheumatology Reports, 13(7), 2207-2215 (2007)
Sean G Rudd et al.
EMBO molecular medicine, 12(3), e10419-e10419 (2020-01-18)
The deoxycytidine analogue cytarabine (ara-C) remains the backbone treatment of acute myeloid leukaemia (AML) as well as other haematological and lymphoid malignancies, but must be combined with other chemotherapeutics to achieve cure. Yet, the underlying mechanism dictating synergistic efficacy of
Nina M S Gustafsson et al.
Nature communications, 9(1), 3872-3872 (2018-09-27)
The glycolytic PFKFB3 enzyme is widely overexpressed in cancer cells and an emerging anti-cancer target. Here, we identify PFKFB3 as a critical factor in homologous recombination (HR) repair of DNA double-strand breaks. PFKFB3 rapidly relocates into ionizing radiation (IR)-induced nuclear
Visualizza tutti i documenti correlati

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.