WH0004171M1

Monoclonal Anti-MCM2 antibody produced in mouse

clone 6A8, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-BM28, Anti-CCNL1, Anti-CDCL1, Anti-D3S3194, Anti-KIAA0030, Anti-MCM2 minichromosome maintenance deficient 2, mitotin (S. cerevisiae), Anti-MGC10606, Anti-MITOTIN, Anti-cdc19
• Numero MDL: MFCD02263650
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 6A8, monoclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: immunoprecipitation (IP): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• N° accesso Genebanck: BC007670
• N° accesso UniProt: P49736
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... MCM2(4171)

Descrizione

Descrizione generale

The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein forms a complex with MCM4, 6, and 7, and has been shown to regulate the helicase activity of the complex. This protein is phosphorylated, and thus regulated by, protein kinases CDC2 and CDC7. (provided by RefSeq)

Immunogeno

MCM2 (AAH07670, 805 a.a. ~ 904 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMILQQF

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 12 - Non Combustible Liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)