WH0004082M6

Monoclonal Anti-MARCKS antibody produced in mouse

clone 2C2, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-80KL, Anti-FLJ14368, Anti-MACS, Anti-MRACKS, Anti-PKCSL, Anti-PRKCSL, Anti-myristoylated alanine-rich protein kinase C substrate
• Numero MDL: MFCD01633619
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 2C2, monoclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: mouse
• tecniche: immunofluorescence: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG1κ
• N° accesso Genebanck: NM_002356
• N° accesso UniProt: P26645
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... MARCKS(4082)

Descrizione

Descrizione generale

Myristoylated alanine-rich C-kinase substrate (MARCKS) contains an N-terminal domain (ND), effector domain (ED), and myristoylated MH2 domain. The MARCKS gene is mapped to human chromosome 6q21.

Immunogeno

MARCKS (NP_002347, 2 a.a. ~ 65 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAESGAKEELQANGSAP

Applicazioni

Monoclonal Anti-MARCKS antibody produced in mouse has been used in immunohistochemistry (1:400).

Azioni biochim/fisiol

Myristoylated alanine-rich C-kinase substrate (MARCKS) is involved in mediating brain plasticity, inflammatory response, embryonic development, and regeneration processes. It also plays a key role in cell cycle regulation and transmembrane transport. Various studies have implicated the association of MARCKS with the pathophysiology of glioblastoma, cholangiocarcinoma, melanoma, and many more tumor types.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)