WH0003753M1

Monoclonal Anti-KCNE1 antibody produced in mouse

clone 5B12, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-ISK, Anti-JLNS, Anti-LQT5, Anti-MGC33114, Anti-MinK, Anti-potassium voltage-gated channel, Isk-related family, member 1
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 5B12, monoclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG1κ
• N° accesso Genebanck: NM_000219
• N° accesso UniProt: P15382
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... KCNE1(3753)

Descrizione

Descrizione generale

The product of this gene belongs to the potassium channel KCNE family. Potassium ion channels are essential to many cellular functions and show a high degree of diversity, varying in their electrophysiologic and pharmacologic properties. This gene encodes a transmembrane protein known to associate with the product of the KVLQT1 gene to form the delayed rectifier potassium channel. Mutation in this gene are associated with both Jervell and Lange-Nielsen and Romano-Ward forms of long-QT syndrome. Alternatively spliced transcript variants encoding the same protein have been identified. (provided by RefSeq)

Immunogeno

KCNE1 (NP_000210, 67 a.a. ~ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)