WH0003673M1
Monoclonal Anti-ITGA2 antibody produced in mouse
clone 2B6, purified immunoglobulin, buffered aqueous solution
Sinonimo/i:
Anti-BR, Anti-CD49B, Anti-GPIa, Anti-VLA2, Anti-VLAA2, Anti-integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor)
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Prodotti consigliati
Origine biologica
mouse
Coniugato
unconjugated
Forma dell’anticorpo
purified immunoglobulin
Tipo di anticorpo
primary antibodies
Clone
2B6, monoclonal
Forma fisica
buffered aqueous solution
Reattività contro le specie
human
tecniche
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL
Isotipo
IgG1κ
N° accesso Genebanck
N° accesso UniProt
Condizioni di spedizione
dry ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... ITGA2(3673)
Descrizione generale
Integrin α2 (ITGA2) is a collagen receptor that is present on the platelets and epithelial cells. This protein is highly expressed in normal epithelial cells. The ITGA2 gene is located on the human chromosome at 5q11.2.
Immunogeno
ITGA2 (NP_002194.2, 30 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
YNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLIL
Sequence
YNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLIL
Azioni biochim/fisiol
Integrin α2 subunit (ITGA2) plays a role in angiogenesis, cell migration, invasion, and cell survival. This protein acts as a tumor activator in several tumors. ITGA2 protein might be involved in cell adhesion and cell-surface mediated signaling and is highly expressed in several cancers. Overexpression of the ITGA2 gene is observed in pancreatic ductal adenocarcinoma and ovarian cancer.
Integrin subunit α 2 (ITGA2) functions as a platelet receptor of collagen, which is an important activating agent required for platelet aggregation. Mutation in the gene might lead to aspirin insensitivity mainly in Chinese populations and in aspirin semi-resistance. Integrin α2β1 serves as a receptor for collagen and many other extracellular matrix (ECM) complexes. Variation in the gene elevates the expression of α2β1 on platelets and increase the risk of having melanoma, gastric, ovarian cancer, thrombosis, myocardial infarction and stroke. Thus, Integrin α2β1 acts as a potential therapeutic target for thrombosis related diseases, cancer, and inflammation. Cryptosporidium parvum infection, elevates the expression of ITGA2 in the host cell. Therefore, silencing the expression of the ITGA2 by using specific antibodies and the ligand type I collagen (collagen-I), is considered as a promising therapeutic method for treatment of cryptosporidial infection.
Stato fisico
Solution in phosphate buffered saline, pH 7.4
Note legali
GenBank is a registered trademark of United States Department of Health and Human Services
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Non trovi il prodotto giusto?
Prova il nostro Motore di ricerca dei prodotti.
Codice della classe di stoccaggio
10 - Combustible liquids
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Dispositivi di protezione individuale
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Certificati d'analisi (COA)
Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Integrin a2 (ITGA2)
Jyrki Heino
Encyclopedia of Signaling Molecules, 962-966 null
Liang Zhang et al.
Pathology oncology research : POR, 25(4), 1545-1552 (2018-12-06)
ITGA2 (Integrin alpha-2) has been detected to be over-expressed in a number of cancers and has been suggested to be involved in cell adhesion and cell-surface mediated signaling. Our previous study using bioinformatic analyses has shown that ITGA2 might be
Linlin Ma et al.
Aging, 12(6), 5336-5351 (2020-03-24)
Ovarian cancer is one of the most malignant tumors of the female reproductive system, with high invasiveness. The disease is a severe threat to women's health. The ITGA2 gene, which codes for integrin subunit α2, is involved in the proliferation
Haili Zhang et al.
Infection and immunity, 80(5), 1753-1758 (2012-02-23)
Cryptosporidium parvum is an opportunistic pathogen in AIDS patients. It is an intracellular but extracytoplasmic parasite residing in a host cell-derived parasitophorous vacuole. It is still poorly understood how this parasite interacts with host cells. We observed that expression of
Wen Ding et al.
PloS one, 10(8), e0135128-e0135128 (2015-08-11)
The loss of ITGA2 plays an important role in cancer metastasis in several solid cancers. However, the molecular mechanism of ITGA2 loss in primary cancers remains unclear. In this study, we found that a lower ITGA2 protein level was observed
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.