WH0003569M1

Monoclonal Anti-IL6 antibody produced in mouse

clone 3E4, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-BSF2, Anti-HGF, Anti-HSF, Anti-IFNB2, Anti-IL6, Anti-interleukin 6 (interferon, beta 2)
• Numero MDL: MFCD00162579
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 3E4, monoclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2bκ
• N° accesso Genebanck: NM_000600
• N° accesso UniProt: P05231
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... IL6(3569)

Descrizione

Descrizione generale

Interleukin-6 (IL-6) is a proinflammatory cytokine. The gene encoding it has five exons and is located on human chromosome 7. Human IL-6 is a 21–26 kDa glycoprotein. It has 212 amino acids along with a 28-amino-acid-signal peptide.

This gene encodes a cytokine that functions in inflammation and the maturation of B cells. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. (provided by RefSeq)

Immunogeno

IL6 (NP_000591, 29 a.a. ~ 212 a.a) recombinant protein.

Sequence
SPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Azioni biochim/fisiol

Interleukin-6 (IL-6) plays a vital role in intracellular signaling pathways. The protein is linked with cancerous cell metastasis and growth. IL-6 serves as a modulator of estrogen synthesis and aromatase activity. IL-6 stimulates immunoglobulin synthesis.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)