WH0001958M3

Monoclonal Anti-EGR1 antibody produced in mouse

clone 6E8, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-AT225, Anti-G0S30, Anti-KROX24, Anti-NGFIA, Anti-TIS8, Anti-ZIF268, Anti-ZNF225, Anti-early growth response 1
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 6E8, monoclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: mouse
• tecniche: immunofluorescence: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• N° accesso Genebanck: NM_001964
• N° accesso UniProt: P08046
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... EGR1(1958)

Descrizione

Descrizione generale

Early-growth response 1 gene (EGR1) is encoded by the gene mapped to human chromosome 5q31.2. The gene codes for a member of the WT-1 family of transcription factors, which contains three Cys2His2 Zn fingers.

The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppresor gene. (provided by RefSeq)

Immunogeno

EGR1 (NP_001955, 444 a.a. ~ 543 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC

Azioni biochim/fisiol

Early-growth response 1 gene (EGR1) facilitates the cellular response to mitogens, stress stimuli and growth factors. It also functions as a tumor suppressor gene in various human cancers. In addition, EGR1 is implicated in the direct regulation of several tumor suppressors such as transforming growth factor β1(TGFβ1), phosphatase and tensin homolog (PTEN), p53 and fibronectin. Mutation in the gene is associated with the development of myeloid disorders.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)