WH0001486M1

Monoclonal Anti-CTBS antibody produced in mouse

clone 1B5-1B9, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-CTB, Anti-chitobiase, di-N-acetyl-
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 1B5-1B9, monoclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG1κ
• N° accesso Genebanck: BC024007
• N° accesso UniProt: Q01459
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... CTBS(1486)

Descrizione

Descrizione generale

The gene CTBS (chitobiase) is mapped to human chromosome 1p22. The gene spans a length of approximately 20kb with seven exons interspaced by six introns. The 5′-flanking region of human chitobiase gene is rich in GC-content.

Immunogeno

CTBS (AAH24007.2, 37 a.a. ~ 105 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DCPCPEPELCRPIRHHPDFEVFVFDVGQKTWKSYDWSQITTVATFGKYDSELMCYAHSKGARVVLKGNL

Azioni biochim/fisiol

The gene CTBS (chitobiase) encodes a lysosomal glycosidase that functions in the degradation of asparagine-linked glycoproteins. It cleaves the reducing-end N-Acetylglucosamine residues from the chitobiose core of oligosaccharides.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)