Passa al contenuto
Merck
Tutte le immagini(5)

Documenti fondamentali

WH0000999M1

Sigma-Aldrich

Monoclonal Anti-CDH1 antibody produced in mouse

clone 3F4, purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

Anti-Arc1, Anti-CDHE, Anti-ECAD, Anti-LCAM, Anti-UVO, Anti-cadherin 1, type 1, E-cadherin (epithelial)

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Numero MDL:
Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

mouse

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

3F4, monoclonal

Stato

buffered aqueous solution

Reattività contro le specie

human

tecniche

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
proximity ligation assay: suitable
western blot: 1-5 μg/mL

Isotipo

IgG1κ

N° accesso Genebanck

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... CDH1(999)

Descrizione generale

Cadherin 1 (CDH1), a transmembrane glycoprotein is present on the epithelial cell surface. It comprises a single transmembrane region, large extracellular domain, and a short cytoplasmic domain. The CDH1 gene is mapped to human chromosome 16q22.1. It is expressed in the embryonic stage especially during lip and palate development.

Immunogeno

CDH1 (NP_004351, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDGGQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDV

Applicazioni

Monoclonal Anti-CDH1 antibody produced in mouse has been used in immunohistochemistry and western blotting. 1:2000

Azioni biochim/fisiol

Cadherin 1 (CDH1) interacts with the actin cytoskeleton through its cytoplasmic domain. It plays a key role in epithelial cell-cell adhesion, maintaining tissue integrity, and migration of cells. CDH1 may also participate in the wingless (wnt) signal transduction pathway. Mutations in CDH1 are implicated in lobular breast cancer ovary cancer and blepharocheilodontic (BCD) syndrome characterized with cleft lip/palate, and ectodermal dysplasia.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Raccomandato

N° Catalogo
Descrizione
Determinazione del prezzo

Codice della classe di stoccaggio

10 - Combustible liquids

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

D M Levi et al.
American journal of optometry and physiological optics, 53(8), 433-439 (1976-08-01)
A stratified probability sample of the Houston, Texas population was interviewed with a previously described questionnaire (Allen, D., and D. Levi, National Health and Optometry--a survey of public attitudes. Am. J. Optom., 52 (4): 291-300, (1975) to assess present opinion
C Bazzoni et al.
Minerva chirurgica, 47(15-16), 1261-1263 (1992-08-01)
The paper reports 14 cases of squamous papilloma of the esophagus which were removed using an endoscopic method: this is a comparatively rare benign pathology of which an increasing number of cases have been recently observed. Endoscopic controls were carried
José Roberto F Caldeira et al.
BMC cancer, 6, 48-48 (2006-03-04)
The E-cadherin gene (CDH1) maps, at chromosome 16q22.1, a region often associated with loss of heterozygosity (LOH) in human breast cancer. LOH at this site is thought to lead to loss of function of this tumor suppressor gene and was
Nives Pećina-Slaus
Cancer cell international, 3(1), 17-17 (2003-11-14)
E-cadherin tumor suppressor genes are particularly active area of research in development and tumorigenesis. The calcium-dependent interactions among E-cadherin molecules are critical for the formation and maintenance of adherent junctions in areas of epithelial cell-cell contact. Loss of E-cadherin-mediated-adhesion characterises
Jamal Ghoumid et al.
Genetics in medicine : official journal of the American College of Medical Genetics, 19(9), 1013-1021 (2017-03-17)
Blepharocheilodontic (BCD) syndrome is a rare autosomal dominant condition characterized by eyelid malformations, cleft lip/palate, and ectodermal dysplasia. The molecular basis of BCD syndrome remains unknown. We recruited 11 patients from 8 families and performed exome sequencing for 5 families

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.