Passa al contenuto
Merck
Tutte le immagini(2)

Key Documents

WH0000767M1

Sigma-Aldrich

Monoclonal Anti-CA8 antibody produced in mouse

clone 1F7, purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

Anti-CALS, Anti-CARP, Anti-CAVIII, Anti-MGC120502, Anti-MGC99509, Anti-carbonic anhydrase VIII

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(2)

About This Item

Numero MDL:
MFCD00164711
Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

mouse

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

1F7, monoclonal

Forma fisica

buffered aqueous solution

Reattività contro le specie

human

tecniche

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG3κ

N° accesso Genebanck

NM_004056

N° accesso UniProt

P35219

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... CA8(767)

Descrizione generale

The protein encoded by this gene was initially named CA-related protein because of sequence similarity to other known carbonic anhydrase genes. However, the gene product lacks carbonic anhydrase activity (i.e., the reversible hydration of carbon dioxide). The gene product continues to carry a carbonic anhydrase designation based on clear sequence identity to other members of the carbonic anhydrase gene family. The absence of CA8 gene transcription in the cerebellum of the lurcher mutant in mice with a neurologic defect suggests an important role for this acatalytic form. (provided by RefSeq)

Immunogeno

CA8 (NP_004047, 40 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPME

Azioni biochim/fisiol

Mutations in CA8 (carbonic anhydrase 8) gene causes neuropathology, such as ataxia, mild mental retardation and the predisposition to quadrupedal gait. It is also associated with the development of colorectal and lung cancers. Additionally, it is upregulated in various cancers.

Caratteristiche e vantaggi

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Min-Syuan Huang et al.
Biochimica et biophysica acta, 1840(9), 2829-2842 (2014-05-06)
Carbonic anhydrase 8 (CA8) is an isozyme of α-carbonic anhydrases (CAs). Previous studies showed that CA8 can be detected in human adult brain, with more intense expression in the cerebellum. Single mutations in CA8 were reported to cause novel syndromes
Ashok Aspatwar et al.
Current pharmaceutical design, 16(29), 3264-3276 (2010-09-08)
Mammalian carbonic anhydrase (α-CA) gene family comprises sixteen isoforms, thirteen of which are active isozymes and three isoforms lack classical CA activity of reversible hydration of CO(2) due to absence of one or more histidine residues required for CA catalytic
Makoto Nishikata et al.
Molecular carcinogenesis, 46(3), 208-214 (2007-01-16)
Increased expression of carbonic anhydrase-related protein (CA-RP) VIII has previously been shown in colorectal carcinoma. Since CA-RP has no catalytic carbonic anhydrase (CA) activity, the present study attempted to elucidate its biological significance in colon cancer cells. From a colon
Namik Kaya et al.
American journal of medical genetics. Part B, Neuropsychiatric genetics : the official publication of the International Society of Psychiatric Genetics, 156B(7), 826-834 (2011-08-04)
We define the neurological characteristics of familial cases from multiple branches of a large consanguineous family with cerebellar ataxia, mental retardation (MR), and dysequilibrium syndrome type 3 caused by a mutation in the recently cloned CA8 gene. The linkage analysis

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.