SAB5702019

Anti-β-arrestin1 Antibody, clone F7C2, Rabbit Monoclonal

• Sinonimo/i: ARRB1,ARB1,ARR1
• Codice UNSPSC: 12352203
• NACRES: NA.46
• Clone: F7C2, monoclonal
• application: WB
• Reattività contro le specie: mouse, mouse
• tecniche: western blot: 1:500 - 1:2000

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Materiali: colorless
• Clone: F7C2, monoclonal
• Stato: liquid
• PM: 51 kDa
• Reattività contro le specie: mouse, mouse
• Concentrazione: 1.00 mg/mL
• tecniche: western blot: 1:500 - 1:2000
• Colore: colorless
• Isotipo: IgG
• Sequenza immunogenica: MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRL
• N° accesso UniProt: P49407
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... ARRB1(408)

Descrizione

Descrizione generale

Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 1 is a cytosolic protein and acts as a cofactor in the beta-adrenergic receptor kinase (BARK) mediated desensitization of beta-adrenergic receptors. Besides the central nervous system, it is expressed at high levels in peripheral blood leukocytes, and thus the BARK/beta-arrestin system is believed to play a major role in regulating receptor-mediated immune functions. Alternatively spliced transcripts encoding different isoforms of arrestin beta 1 have been described.

Immunogeno

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human β-arrestin1 (P49407).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Applicazioni

WB

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1