SAB2108899

Anti-PDYN antibody produced in rabbit biotin conjugated

affinity isolated antibody

• Sinonimo/i: C3orf59
• Codice UNSPSC: 12352203
• NACRES: NA.45

Proprietà

• Origine biologica: rabbit
• Coniugato: biotin conjugate
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 27 kDa
• Reattività contro le specie (prevista in base all’omologia): rabbit, horse, canine, guinea pig, human, goat, bovine, sheep, mouse, zebrafish
• Concentrazione: 0.5 mg/mL
• N° accesso NCBI: NM_024411
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... PDYN(5173)

Descrizione

Descrizione generale

The protein encoded by this gene is a preproprotein that is proteolytically processed to form the secreted opioid peptides beta-neoendorphin, dynorphin, leu-enkephalin, rimorphin, and leumorphin. These peptides are ligands for the kappa-type of opioid receptor. Dynorphin is involved in modulating responses to several psychoactive substances, including cocaine. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.

Immunogeno

Synthetic peptide directed towards the middle region of human PDYN

Sequenza

Synthetic peptide located within the following region: SELMRDAQLNDGAMETGTLYLAEEDPKEQVKRYGGFLRKYPKRSSEVAGE

Stato fisico

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): nwg
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable