SAB2108772

Anti-PAX2 antibody produced in rabbit biotin conjugated

affinity isolated antibody

• Sinonimo/i: CPT1-M, CPT1M, CPTI, KIAA1670, M-CPT1
• Codice UNSPSC: 12352203
• NACRES: NA.45

Proprietà

• Origine biologica: rabbit
• Coniugato: biotin conjugate
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 42 kDa
• Reattività contro le specie (prevista in base all’omologia): guinea pig, rat, horse, canine, mouse, rabbit, bovine, zebrafish, human
• Concentrazione: 0.5 mg/mL
• N° accesso NCBI: NM_000278
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... PAX2(5076)

Descrizione

Descrizione generale

PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia.

Immunogeno

Synthetic peptide directed towards the middle region of Human PAX2

Sequenza

Synthetic peptide located within the following region: DPVGSYSINGILGIPRSNGEKRKRDEDVSEGSVPNGDSQSGVDSLRKHLR

Stato fisico

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): nwg
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable