SAB2108757

Anti-SLC10A1

affinity isolated antibody

• Sinonimo/i: Anti- NTCP1, Anti-NTCP
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 38 kDa
• Reattività contro le specie: mouse, human, guinea pig, dog, rat
• Concentrazione: 0.5-1 mg/mL
• tecniche: immunoblotting: suitable
• Numero d’accesso: NM_003049
• N° accesso UniProt: Q14973
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... SLC10A1(6554)

Descrizione

Descrizione generale

The gene SLC10A1 (solute carrier family 10 member 1) is mapped to human chromosome 14q24.2. It is mainly expressed in the liver cells.

Immunogeno

Synthetic peptide directed towards the middle region of human SLC10A1

Azioni biochim/fisiol

SLC10A1 (solute carrier family 10 member 1) is a bile acid transporter. It plays an important role in the circulation of bile acids. Mutation in this gene is associated with hypercholanemia. SLC10A1 also plays an important role in the entry of HBV (Hepatitis B virus) and silencing of this gene inhibits HBV infection. It works as a receptor for preS1 domain in HBV.

Sequenza

Synthetic peptide located within the following region: VFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPY

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable