Passa al contenuto
Merck
Tutte le immagini(4)

Documenti fondamentali

SAB2108752

Sigma-Aldrich

Anti-WT1

affinity isolated antibody

Sinonimo/i:

Anti- AWT1, Anti- WAGR, Anti- WIT-2, Anti- WT33, Anti-GUD

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

56 kDa

Reattività contro le specie

human, rabbit, dog, rat, mouse

Concentrazione

0.5-1 mg/mL

tecniche

immunoblotting: suitable
immunohistochemistry: suitable

Numero d’accesso

NM_024424

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... WT1(7490)

Descrizione generale

Wilms tumor 1 (WT1) gene is located on 11p13 in the human chromosome.

Immunogeno

Synthetic peptide directed towards the middle region of human WT1

Azioni biochim/fisiol

WT1 is a transcription factor that contains four zinc-finger motifs at the C-terminus and a proline/glutamine-rich DNA-binding domain at the N-terminus. It has an essential role in the normal development of the urogenital system. WT1 has both oncogenic and tumor suppressor properties, and also acts as a transcription factor at the early organ developmental stage. WT1 regulates the mesenchyme and modulates the development of mesodermal organs. WT1 is known to cause kidney cancer or nephroblastoma in children. Mutations in WT1 causes diseases of urogenital system like Denys-Drash syndrome, Frasier syndrome. WT1 is being associated with haematological malignancies and solid tumours.

Sequenza

Synthetic peptide located within the following region: DHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLA

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

The role of Wt1 in regulating mesenchyme in cancer, development, and tissue homeostasis
Chau YY and Hastie ND
Trends in Genetics, 28(10), 515-524 (2012)
New insights into DNA-binding behaviour of Wilms Tumor Protein (WT1)?A dual study
Nurmemmedov E, et al.
Biophysical Chemistry, 145(2-3), 116-125 (2009)
The tumor suppressor WTX shuttles to the nucleus and modulates WT1 activity
Rivera et al.
Proceedings of the National Academy of Sciences of the USA, 106(20), 8338-8343 (2009)
Donor splice-site mutations in WT1 are responsible for Frasier syndrome
Barbaux S, et al.
Nature Genetics, 17(4), 467-467 (1997)
Structure of the Wilms tumor suppressor protein zinc finger domain bound to DNA
Stoll R, et al.
Journal of Molecular Biology, 372(5), 1227-1245 (2007)

Global Trade Item Number

SKUGTIN
SAB2108752-100UL4061836137243

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.