Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

SAB2107115

Sigma-Aldrich

Anti-KRAS antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-C-K-RAS, Anti-CFC2, Anti-K-RAS2A, Anti-K-RAS2B, Anti-K-RAS4A, Anti-K-RAS4B, Anti-K-Ras, Anti-K-Ras 2, Anti-KRAS1, Anti-KRAS2, Anti-NS, Anti-NS3, Anti-OES, Anti-RALD, Anti-RASK2, Anti-c-Ki-ras, Anti-c-Ki-ras2

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

20 kDa

Reattività contro le specie

human, rabbit, bovine, rat, guinea pig, horse, dog, mouse

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... KRAS(3845)
rat ... Kras(24525)

Immunogeno

The immunogen for anti-KRAS antibody: synthetic peptide derected towards the N terminal of human KRAS

Azioni biochim/fisiol

Kras is a oncogene and member of the small GTPase superfamily.

Sequenza

Synthetic peptide located within the following region: QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVP

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Wulamujiang Aini et al.
Transplant immunology, 31(2), 55-59 (2014-07-06)
In living donor liver transplantation, the biological organ age of the donated allograft is unknown in young patients who receive grafts from older donors. Few studies have focused on the effects of aging on allografts in the state of tolerance.
Hua Yang et al.
Anti-cancer drugs, 25(7), 767-777 (2014-04-02)
Histone deacetylase inhibitors are a new class of anticancer agents that inhibit cancer cell proliferation and induce apoptosis and cell cycle arrest in various cancer cells. Recently, we identified ZYJ-34c, a modified histone deacetylase inhibitor that showed significantly higher antitumor
Maria Angelica Cortez et al.
Molecular therapy : the journal of the American Society of Gene Therapy, 22(8), 1494-1503 (2014-05-06)
The microRNA (miR)-200s and their negative regulator ZEB1 have been extensively studied in the context of the epithelial-mesenchymal transition. Loss of miR-200s has been shown to enhance cancer aggressiveness and metastasis, whereas replacement of miR-200 miRNAs has been shown to
Ki Hwan Kweon et al.
International journal of oncology, 45(5), 2065-2075 (2014-08-12)
Despite the favorable therapeutic outcomes reported in differentiated thyroid cancer (DTC), a significant proportion of DTC patients present with refractory behavior to conventional therapy. The sirtuin (Sirt) family has recently been implicated in the maintenance of cellular homeostasis under genotoxic
Joseph Carver et al.
PloS one, 9(8), e103836-e103836 (2014-08-06)
Mutations in the Ras family of small GTPases, particularly KRAS, occur at high frequencies in cancer and represent a major unmet therapeutic need due to the lack of effective targeted therapies. Past efforts directed at inhibiting the activity of the

Global Trade Item Number

SKUGTIN
SAB2107115-100UL4061836113896
SAB2107115-50UG

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.