SAB2102370

Anti-TAP1 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-ABC17, Anti-ABCB2, Anti-APT1, Anti-D6S114E, Anti-Transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)
• Numero MDL: MFCD00283209
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 87 kDa
• Reattività contro le specie: human, rat, mouse
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso UniProt: Q03518
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... TAP1(6890)

Descrizione

Descrizione generale

The transporter protein associated with antigen processing-1 (TAP1) belongs to the major histocompatibility complex (MHC) class I peptide-loading complex. TAP1 is also termed as the partner of sld five 1 (PSF1). PSF1 belongs to the heterotetrameric complex, known as GINS. It is located on human chromosome 6p21.

Immunogeno

Synthetic peptide directed towards the middle region of human TAP1

Applicazioni

Anti-TAP1 antibody has been used in immunoprecipitation.

Azioni biochim/fisiol

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). TAP1 is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. TAP1 is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease.
Knockdown of PSF1 expression blocks the multiplication of cell in lung cancer cells in vitro.

Sequenza

Synthetic peptide located within the following region: LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable