SAB1410844

Anti-NNMT antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: antigen 29.6 kDa
• Reattività contro le specie: human, mouse
• tecniche: western blot: 1 μg/mL
• N° accesso NCBI: NM_006169.2
• N° accesso UniProt: P40261
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... NNMT(4837)

Descrizione

Descrizione generale

The nicotinamide N-methyltransferase (NNMT) gene, spanning 16.5kb of genomic DNA with three exons and two introns, is mapped to human chromosome 11q23.1. The encoded protein consists of 264 amino acids with a predicted molecular mass of 29.6kDa. NNMT is expressed in cytoplasm.

Immunogeno

NNMT (NP_006160.1, 1 a.a. ~ 264 a.a) full-length human protein.

Sequence
MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL

Azioni biochim/fisiol

Nicotinamide N-methyltransferase (NNMT) is a cytosolic methyltransferase enzyme. It catalyzes the N-methylation of nicotinamide, pyridines and other structural analogs. Hence, it plays a vital role in the biotransformation and detoxification of various xenobiotic compounds. Altered expression of the gene is associated with the pathogenesis of various diseases such as acute lymphoblastic leukemia (ALL), parkinson′s disease, thyroid cancer, gastric cancer, colorectal cancer, lung, liver and oral carcinomas. In addition, variation in the gene might increase the risk of susceptibility to hyperlipidemia and migraine.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable