SAB1410815

Anti-PPP1R12B antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: MGC131980, MGC87886, MYPT2
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: antigen 43.3 kDa
• Reattività contro le specie: human
• tecniche: western blot: 1 μg/mL
• N° accesso NCBI: ENST00000356764
• N° accesso UniProt: O60237
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... PPP1R12B(4660)

Descrizione

Descrizione generale

Myosin light chain phosphatase (MLCP) consists of three subunits- catalytic subunit, large subunit/myosin binding subunit (MBS) and small subunit (sm-M20). This gene is a multi-functional gene which encodes both MBS and sm-M20. MLCP regulates myosins and the dephosphorylation is enhanced by the presence of MBS. The sm-M20 is suggested to play a regulatory role in muscle contraction by binding to MBS. MBS is also encoded by another gene, myosin light chain phosphatase target subunit 1. sm-M20 shows higher binding affinity to this gene product than to myosin light chain phosphatase target subunit 2-MBS even though the two MBS proteins are highly similar. Although both MBSs increase the activity of MLCP, myosin light chain phosphatase target subunit 1-MBS is a more efficient activator. There are four alternatively spliced transcript variants described; two alter the MBS coding region and two alter the sm-M20 coding region of this gene. (provided by RefSeq)

Immunogeno

PPP1R12B (ENSP00000349206, 1 a.a. ~ 386 a.a) full-length human protein.

Sequence
MAELEHLGGKRAESARMRRAEQLRRWRGSLTEQEPAERRGAGRQPLTRRGSPRVRFEDGAVFLAACSSGDTDEVRKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQDNEGWTPLHAAASCGYLNIAEYFINHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQGVDLEQSRKEEEQQMLQDARQWLNSGKIEDVRQARSGATALHVAAAKGYSEVLRLLIQAGYELNVQDYDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLELLQKKQNVLRSEKETRNKLIESDLNSKIQSGFFKNKEKMLYEEETPKSQEMEEENKESSSSSSEEEEGEDEASESETEKEAVLFWPF

Azioni biochim/fisiol

PPP1R12B (protein phosphatase 1 regulatory subunit 12B) is associated with childhood asthma. It is a part of the myosin phosphatase complex. The complex controls contractile responses in muscle and nonmuscle cells. PPP1R12B is upregulated in disorders, including ischaemia, atrial fibrillation, myocardial infarction and cardiomyopathy.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable