SAB1403667

Monoclonal Anti-CHD4 antibody produced in mouse

clone 4H4, ascites fluid

• Sinonimo/i: DKFZp686E06161, Mi-2b, Mi2-BETA
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: ascites fluid
• Tipo di anticorpo: primary antibodies
• Clone: 4H4, monoclonal
• PM: antigen ~37 kDa
• Reattività contro le specie: human
• tecniche: indirect ELISA: suitable; western blot: 1:500-1:1000
• Isotipo: IgG2aκ
• N° accesso NCBI: NM_001273
• N° accesso UniProt: Q14839
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... CHD4(1108)

Descrizione

Descrizione generale

The product of this gene belongs to the SNF2/RAD54 helicase family. It represents the main component of the nucleosome remodeling and deacetylase complex and plays an important role in epigenetic transcriptional repression. Patients with dermatomyositis develop antibodies against this protein. (provided by RefSeq)

Immunogeno

CHD4 (NP_001264, 1632 a.a. ~ 1730 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETPKDLNDEKQKKNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWH

Stato fisico

Clear solution

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 11 - Combustible Solids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable