SAB1402221

Monoclonal Anti-HK2, (C-terminal) antibody produced in mouse

clone 4H1, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: DKFZp686M1669, HKII, HXK2
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 4H1, monoclonal
• Forma fisica: buffered aqueous solution
• PM: antigen ~37 kDa
• Reattività contro le specie: human, rat
• tecniche: capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• N° accesso NCBI: BC021116
• N° accesso UniProt: P52789
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... HK2(3099)

Descrizione

Descrizione generale

Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes hexokinase 2, the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this gene is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells. (provided by RefSeq)

Immunogeno

HK2 (AAH21116, 818 a.a. ~ 917 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
IVKEVCTVVARRAAQLCGAGMAAVVDRIRENRGLDALKVTVGVDGTLYKLHPHFAKVMHETVKDLAPKCDVSFLQSEDGSGKGAALITAVACRIREAGQR

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable