Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

MSST0040

Sigma-Aldrich

SILuLite IFNG Interferon Gamma human

recombinant, expressed in HEK 293 cells, MS Protein Standard

Sinonimo/i:

IFNγ, IFN-gamma, Immune interferon, Immuneinterferon

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
23201100
NACRES:
NA.12

Origine biologica

human

Livello qualitativo

Ricombinante

expressed in HEK 293 cells

Saggio

≥98% (SDS-PAGE)

Stato

lyophilized powder

Potenza

≥98% Heavy amino acids incorporation efficiency by MS

PM

calculated mol wt 17 kDa

tecniche

mass spectrometry (MS): suitable

Compatibilità

suitable for mass spectrometry (internal calibrator)

N° accesso UniProt

Temperatura di conservazione

−20°C

Informazioni sul gene

human ... IFNG(3458)

Descrizione generale

Interferon gamma (IFNγ) is a dimerized soluble cytokine that is the only member of the type II class of interferons. IFNγ is secreted by T helper cells (specifically, Th1 cells), cytotoxic T cells (TC cells) and Natural killer (NK) cells. When combined with other inflammatory cytokines, evaluating the levels of IFNγ can be used as a diagnostic tool in patients with breast cancer or benign prostatic hyperplasia. A recent study evaluated the effect of a cancer vaccine given to patients with colorectal cancer, on the levels of plasma pro-inflammatory cytokines (including IFN-γ). The study concluded that patients achieving stable disease showed increasing levels of plasma inflammatory cytokines.

Immunogeno

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG

Azioni biochim/fisiol

SILuLite IFNG is a recombinant human protein expressed in human 293 cells. It is a homodimer consisting of 138 amino acids Expressed in human 293 cells, with a calculated molecular mass of 17 kDa. SILu Lite IFNG is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Stato fisico

Lyophilized from a solution of phosphate buffered saline.

Note legali

SILu is a trademark of Sigma-Aldrich Co. LLC

Codice della classe di stoccaggio

11 - Combustible Solids

Classe di pericolosità dell'acqua (WGK)

WGK 2

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.