HPA011562

Anti-TOMM20 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinonimo/i: Anti-Mitochondrial 20 kDa outer membrane protein antibody produced in rabbit, Anti-Mitochondrial import receptor subunit TOM20 homolog antibody produced in rabbit, Anti-Outer mitochondrial membrane receptor Tom20 antibody produced in rabbit
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA011562

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Forma fisica: buffered aqueous glycerol solution
• Reattività contro le specie: mouse, human
• Convalida avanzata: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• tecniche: immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:500-1:1000
• Sequenza immunogenica: KRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDV
• N° accesso UniProt: Q15388
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... TOMM20(9804)

Descrizione

Descrizione generale

Translocase of outer mitochondrial membrane 20 (TOMM20) is mapped to human chromosome 1q42.3. It comprises a N-terminal hydrophobic transmembrane (TM) segment and cytosol exposed C-terminal domain. TOMM20 also has glutamine rich acidic regions and a tetratrico peptide repeat (TPR).

Immunogeno

Mitochondrial import receptor subunit TOM20 homolog recombinant protein epitope signature tag (PrEST)

Applicazioni

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Anti-TOMM20 antibody produced in rabbit has been used in:

• western blotting
• confocal laser microscopy
• immunofluorescence

Anti-TOMM20 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Azioni biochim/fisiol

TOMM20 (Translocase of outer mitochondrial membrane 20) is a major mitochondrial protein receptor involved in the cytosolic protein import phenomena. It is localized in the cytoplasm of spiral ganglia neurons. It functions as a subunit of a protein import complex to identify and translocate specific cytosolic proteins into the mitochondrial outer membrane. Study shows that TOMM20 acts as a biomarker in identifying the mitochondrial mass and oxidative phosphorylation in several cancer types.

TOMM20 anchors on the mitochondrial outer membrane via its N-terminal domain. The C-terminal region functions as a receptor for mitochondrial precursor proteins. The tetratrico peptide repeat (TPR) mediates protein-protein interactions. TOMM20 interacts with α-synuclein leading to the inhibition of mitochondrial protein import. Aberration in this interaction is implicated in the pathogenesis of Parkinson′s disease.

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72221

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)