Passa al contenuto
Merck
Tutte le immagini(3)

Documenti fondamentali

AV54575

Sigma-Aldrich

Anti-GFRA2 antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-GDNF family receptor α2, Anti-GDNFRB, Anti-NRTNR-ALPHA, Anti-NTNRA, Anti-RETL2, Anti-TRNR2

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

47 kDa

Reattività contro le specie

horse, dog, mouse, rat, human, pig, rabbit

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

Informazioni sul gene

human ... GFRA2(2675)

Immunogeno

Synthetic peptide directed towards the C terminal region of human GFRA2

Applicazioni

Anti-GFRA2 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Azioni biochim/fisiol

GFRA2 are cell surface bound glycoproteins that mediate interactions of the glial-cell-line-derived neurotrophic factor (GDNF) ligand family with the RET receptor that are crucial for the development of kidney and some peripheral nerve lineages. GFRA2 gene is shown to be associated with tardive dyskinesia in a study. The factors GDNF and neurturin, along with their receptors GFRA1 and GFRA2, respectively, are crucial for enteric neuron survival in human colon. The gene is shown to be associated with schizophrenia and clozapine response in a study. It is associated with severe abdominal pain sensation in pancreatic cancer patients.

Sequenza

Synthetic peptide located within the following region: NVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLK

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

M Barrenschee et al.
Cell and tissue research, 354(2), 371-380 (2013-07-25)
Two of the glial-cell-line-derived neurotrophic factor (GDNF) family ligands (GFLs), namely GDNF and neurturin (NRTN), are essential neurotropic factors for enteric nerve cells. Signal transduction is mediated by a receptor complex composed of GDNF family receptor alpha 1 (GFRα1) for
J B Vanhorne et al.
Human genetics, 108(5), 409-415 (2001-06-21)
The glial-cell-line-derived neurotrophic factor (GDNF) family receptors alpha (GFRalpha) are cell surface bound glycoproteins that mediate interactions of the GDNF ligand family with the RET receptor. These interactions are crucial to the development of the kidney and some peripheral nerve
Renan P Souza et al.
Journal of psychiatric research, 44(11), 700-706 (2010-02-02)
GDNF (glial-cell-line derived neurotrophic factor) is a potent neurotrophic factor for dopaminergic neurons. Neuropsychiatric diseases and their treatments are associated with alterations in the levels of both GDNF and its receptor family (GDNF family receptor alpha or GFRA). GFRA1, GFRA2
Renan P Souza et al.
Psychopharmacology, 210(3), 347-354 (2010-04-07)
Tardive dyskinesia (TD) has a pharmacogenetic component in which the interaction of antipsychotic exposure with individual genetic variation mediates risk. The glial cell line-derived neurotrophic factor (GDNF) signalling pathway has been associated with neuroprotective effects in central dopaminergic neurons and
Kun Wang et al.
Carcinogenesis, 35(1), 103-113 (2013-09-27)
Neurotrophic factors possess an emerging role in the pathophysiology of several gastrointestinal disorders, regulating innervation, pain sensation and disease-associated neuroplasticity. Here, we aimed at characterizing the role of the neurotrophic factor neurturin (NRTN) and its receptor glial-cell-line-derived neurotrophic factor receptor

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.