AV48793

Anti-POLK antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-DINB1, Anti-DINP, Anti-POLQ, Anti-Polymerase (DNA directed) kappa
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 99 kDa
• Reattività contro le specie: mouse, rat, dog, pig, bovine, horse, human
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_057302
• N° accesso UniProt: Q9UBT6
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... POLK(51426)

Descrizione

Descrizione generale

POLK codes for polymerase (DNA directed) κ that facilitates DNA-damage bypass via the extension step of lesion bypass. POLK promoter is negatively regulated by p53.
Rabbit Anti-POLK antibody recognizes human, mouse, rat, canine, and bovine POLK.

Immunogeno

Synthetic peptide directed towards the middle region of human POLK

Applicazioni

Rabbit Anti-POLK antibody is suitable for western blot applications at a concentration of 1μg/ml.

Azioni biochim/fisiol

POLK belongs to the DNA polymerase type-Y family. It contains 2 Rad18-type zinc fingers and 1 umuC domain. POLK is a DNA polymerase specifically involved in DNA repair. It plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls. Depending on the context, it inserts the correct base, but causes frequent base transitions, transversions and frameshifts. It lacks 3′-5′ proofreading exonuclease activity. POLK forms a Schiff base with 5′-deoxyribose phosphate at abasic sites, but does not have lyase activity.

Sequenza

Synthetic peptide located within the following region: ATECTLEKTDKDKFVKPLEMSHKKSFFDKKRSERKWSHQDTFKCEAVNKQ

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable