Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

AV48436

Sigma-Aldrich

Anti-HSPB6 antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-FLJ32389, Anti-Heat shock protein, α-crystallin-related, B6, Anti-Hsp20

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(1)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

17 kDa

Reattività contro le specie

human

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

NP_653218

N° accesso UniProt

O14558

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... HSPB6(126393)

Descrizione generale

HSPB6 (Hsp20) encodes a heat shock protein that may be involved in the relaxation of smooth muscles. It is known to interact with Bag3. HSPB6 has also been implicated in platelet aggregation, atherosclerosis, myocardial infarction, insulin resistance and Alzheimer′s disease.
Rabbit Anti-HSPB6 antibody recognizes canine, bovine, human, mouse, rat, chicken, and pig HSPB6.

Immunogeno

Synthetic peptide directed towards the middle region of human HSPB6

Applicazioni

Rabbit Anti-HSPB6 antibody is suitable for western blot applications at a concentration of 1.25μg/ml.

Azioni biochim/fisiol

HSPB6 is associated with actin and modulates smooth muscle relaxation.HSPB6 is associated with actin (see MIM 102540) and modulates smooth muscle relaxation (Tessier et al., 2003 [PubMed 12842460]).[supplied by OMIM].

Sequenza

Synthetic peptide located within the following region: ARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPAS

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Cerca un COA

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Guo-Chang Fan et al.
Journal of molecular and cellular cardiology, 51(4), 574-577 (2010-09-28)
Hsp20, referred to as HspB6, is constitutively expressed in various tissues. Specifically, HspB6 is most highly expressed in different types of muscle including vascular, airway, colonic, bladder, and uterine smooth muscle; cardiac muscle; and skeletal muscle. It can be phosphorylated
Margit Fuchs et al.
The Biochemical journal, 425(1), 245-255 (2009-10-23)
The molecular chaperone HspB8 [Hsp (heat-shock protein) B8] is member of the B-group of Hsps. These proteins bind to unfolded or misfolded proteins and protect them from aggregation. HspB8 has been reported to form a stable molecular complex with the

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.