Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

AV48038

Sigma-Aldrich

Anti-STRAP (AB1) antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-MAWD, Anti-PT-WD, Anti-Serine/threonine kinase receptor associated protein, Anti-UNRIP

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

38 kDa

Reattività contro le specie

rabbit, guinea pig, horse, rat, dog, human, mouse, bovine

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunohistochemistry: suitable
western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... STRAP(11171)

Descrizione generale

Serine/threonine kinase receptor associated protein (STRAP) is a poly(A) RNA binding protein that modulates type I collagen mRNA translation. It decreases the ubiquitination of Notch3 and negatively regulates ASK1.
Rabbit Anti-STRAP antibody recognizes human, mouse, rat, canine, bovine, and zebrafish STRAP.

Immunogeno

Synthetic peptide directed towards the N terminal region of human STRAP

Applicazioni

Rabbit Anti-STRAP antibody is suitable for IHC applications at a dilution of 1:150 and for western blot applications at a concentration of 0.5μg/ml.

Azioni biochim/fisiol

The SMN complex plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus. STRAP may play a role in the cellular distribution of the SMN complex.

Sequenza

Synthetic peptide located within the following region: HIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEISGHTSGIKKAL

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Isam B Sharum et al.
Reproduction (Cambridge, England), 153(2), 221-231 (2016-11-24)
The molecular mechanisms involved in regulating the development of small, gonadotrophin-independent follicles are poorly understood; however, many studies have highlighted an essential role for TGFB ligands. Canonical TGFB signalling is dependent upon intracellular SMAD proteins that regulate transcription. STRAP has
Wei Liu et al.
Synapse (New York, N.Y.), 68(6), 275-282 (2014-03-01)
Recent studies have shown that transforming growth factor β (TGFβ) signaling participates in the epileptogenesis. Serine-threonine kinase receptor-associated protein (STRAP) and Smad7 synergize in the inhibition of the TGFβ signaling. The aim of the present study was to determine the
Milica Vukmirovic et al.
Molecular and cellular biology, 33(19), 3893-3906 (2013-08-07)
Type I collagen is the most abundant protein in the human body and is composed of two α1(I) and one α2(I) polypeptides which assemble into a triple helix. For the proper assembly of the collagen triple helix, the individual polypeptides
Haiyoung Jung et al.
The Journal of biological chemistry, 285(1), 54-70 (2009-11-03)
Serine-threonine kinase receptor-associated protein (STRAP) interacts with transforming growth factor beta (TGF-beta) receptors and inhibits TGF-beta signaling. Here, we identify STRAP as an interacting partner of ASK1 (apoptosis signal-regulating kinase 1). The association between ASK1 and STRAP is mediated through
Nilesh D Kashikar et al.
Cell cycle (Georgetown, Tex.), 10(10), 1639-1654 (2011-04-20)
Glycogen synthase kinase 3β (GSK3β) can regulate a broad range of cellular processes in a variety of cell types and tissues through its ability to phosphorylate its substrates in a cell- and time-specific manner. Although it is known that Axin

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.