Passa al contenuto
Merck
Tutte le immagini(1)

Key Documents

AV46141

Sigma-Aldrich

Anti-PPIF antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-CYP3, Anti-Cyp-D, Anti-FLJ90798, Anti-MGC117207, Anti-Peptidylprolyl isomerase F (cyclophilin F)

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(1)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

19 kDa

Reattività contro le specie

bovine, rat, dog, horse, rabbit, human, guinea pig, mouse

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

NP_005720

N° accesso UniProt

P30405

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... PPIF(10105)

Immunogeno

Synthetic peptide directed towards the middle region of human PPIF

Applicazioni

Anti-PPIF antibody produced in rabbit is suitable for western blotting at a concentration of 5μg/ml.

Azioni biochim/fisiol

PPIF (peptidylprolyl isomerase F) also referred to as CypD or cyclophilin F belongs to peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases are highly-conserved cytoplasmic enzymes that accelerate protein folding. PPIF is a part of the mitochondrial permeability transition pore (mPTP) in the inner mitochondrial membrane. Hence, it is anticipated that its association with the mPTP masks the binding site for inhibiting inorganic phosphate (Pi) as well as enhances the open possibility of mPTP that results in apoptosis or necrosis.

Sequenza

Synthetic peptide located within the following region: GSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLS

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Angelina V Vaseva et al.
Cell, 149(7), 1536-1548 (2012-06-26)
Ischemia-associated oxidative damage leading to necrosis is a major cause of catastrophic tissue loss, and elucidating its signaling mechanism is therefore of paramount importance. p53 is a central stress sensor responding to multiple insults, including oxidative stress to orchestrate apoptotic
Roman A Eliseev et al.
The Journal of biological chemistry, 284(15), 9692-9699 (2009-02-21)
Cyclophilin D (CypD) is a mitochondrial immunophilin and a key positive regulator of the mitochondrial permeability transition (MPT). Several reports have shown that CypD is overexpressed in various tumors, where it has an anti-apoptotic effect. Because the MPT is a
Yuan He et al.
Investigative ophthalmology & visual science, 49(11), 4912-4922 (2008-07-11)
Disruption in intracellular calcium ion (Ca(2+)) homeostasis has major effects on health. Persistent Ca(2+) overload induces mitochondrial permeability transition pore (MPTP) opening, which prompts mitochondrial release of calcium (mCICR) and reactive oxygen species (ROS) into the cytosol which, in turn
Guohua Gong et al.
Journal of molecular and cellular cardiology, 76, 235-246 (2014-09-25)
The heart is an excitable organ that undergoes spontaneous force generation and relaxation cycles driven by excitation-contraction (EC) coupling. A fraction of the oscillating cytosolic Ca(2+) during each heartbeat is taken up by mitochondria to stimulate mitochondrial metabolism, the major

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.