AV44234

Anti-GUSB antibody produced in rabbit

IgG fraction of antiserum

• Sinonimo/i: Anti-Glucuronidase, β, Anti-MPS7
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: IgG fraction of antiserum
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 72 kDa
• Reattività contro le specie: mouse, horse, guinea pig, rabbit, human
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso NCBI: NP_000172
• N° accesso UniProt: P08236
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... GUSB(2990)

Descrizione

Descrizione generale

β-Glucuronidase (GUSB), a lysosomal enzyme, catalyzes the breakdown of complex carbohydrates by hydrolyzing β-D-glucuronic acid residues from the non-reducing end of mucopolysaccharides. GUSB is a stably expressed gene product that may be used to normalize the expression of other genes in processes such as mesenchymal stem cell differentiation.

Specificità

Anti-GUSB polyclonal antibody reacts with canine, bovine, zebrafish, chicken, human, mouse, rat, and pig β-glucuronidase proteins.

Immunogeno

Synthetic peptide directed towards the C terminal region of human GUSB

Applicazioni

Anti-GUSB polyclonal antibody is used to tag β-glucuronidase protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe detect the presence of β-glucuronidase as a gene expression normalization reference protein.

Azioni biochim/fisiol

GUSB plays an important role in the degradation of dermatan and keratan sulfates.

Sequenza

Synthetic peptide located within the following region: VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable