AV40647

Anti-RNASEH2A antibody produced in rabbit

IgG fraction of antiserum

• Sinonimo/i: Anti-Ribonuclease H2, subunit A
• Codice UNSPSC: 12352203
• NACRES: NA.41
• Coniugato: unconjugated
• application: IHC; WB
• Clone: polyclonal
• Reattività contro le specie: goat, human, pig, bovine, horse
• citations: 1
• tecniche: immunohistochemistry: suitable; western blot: suitable

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: IgG fraction of antiserum
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Stato: buffered aqueous solution
• PM: 33 kDa
• Reattività contro le specie: goat, human, pig, bovine, horse
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso NCBI: NP_006388
• N° accesso UniProt: O75792
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... RNASEH2A(10535)

Descrizione

Immunogeno

Synthetic peptide directed towards the middle region of human RNASEH2A

Azioni biochim/fisiol

Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.

Sequenza

Synthetic peptide located within the following region: AQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLE

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable