AV33271

Anti-SOX17 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-SRY (sex determining region Y)-box 17
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Stato: buffered aqueous solution
• PM: 44 kDa
• Reattività contro le specie: human, pig, dog
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_071899
• N° accesso UniProt: Q9H6I2
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... SOX17(64321)

Descrizione

Descrizione generale

SRY-box (SOX) transcription factors bind the minor groove of DNA to modulate gene expression. SRY-box 17 (SOX17) regulates a variety of developmental processes such as endoderm formation. SOX17 is an antagonist to Wnt/β-catenin pathway cell signaling. SOX17 is a potential biomarker for breast cancer carcinogenesis and progression.

Specificità

Rabbit polyclonal anti-SOX17 antibody reacts with canine, human, and pig SRY (sex determining region Y)-box 17 transcription factors.

Immunogeno

Synthetic peptide directed towards the C terminal region of human SOX17

Azioni biochim/fisiol

The SOX17 gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins.

Sequenza

Synthetic peptide located within the following region: GTDPSQPAELLGEVDRTEFEQYLHFVCKPEMGLPYQGHDSGVNLPDSHGA

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable