AV32880

Anti-PPARG (AB1) antibody produced in rabbit

IgG fraction of antiserum

• Sinonimo/i: Anti-Peroxisome proliferator-activated receptor γ
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: IgG fraction of antiserum
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 56 kDa
• Reattività contro le specie: rabbit, rat, mouse, horse, guinea pig, human, dog
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso NCBI: NP_005028
• N° accesso UniProt: P37231
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... PPARG(5468)

Descrizione

Descrizione generale

Peroxisome proliferator-activated receptor gamma/glitazone receptor (PPARG, NR1C3) is a type II nuclear receptor involved in the regulation of fatty acid storage and glucose metabolism. PPARG activation stimulates lipid uptake and adipocyte differention/adipogenesis. PPARG is a component of pathologies such as diabetes, atherosclerosis, and cancer. PPARG helps regulate the inflammatory response of endothelial cells.

Rabbit polyclonal anti-PPARG (AB1) antibody reacts with bovine, canine, human, mouse, rat, chicken, rabbit, and pig peroxisome proliferator-activated receptor gamma/glitazone receptors.

Immunogeno

Synthetic peptide directed towards the N terminal region of human PPARG

Applicazioni

Rabbit Anti-PPARG has been used at a dilution of 1:50 for IHC applications. It can also be used for western blot at 1.25 μg/ml.

Rabbit polyclonal anti-PPARG (AB1) antibody is used to tag peroxisome proliferator-activated receptor gamma/glitazone for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of peroxisome proliferator-activated receptor gamma/glitazone receptor in lipid and glucose metabolism, adipocyte differentiation and potential associated diseases such as diabetes, atherosclerosis, and cancer.

Azioni biochim/fisiol

PPARG is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer.

Sequenza

Synthetic peptide located within the following region: SHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAI

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable