AV100955

Anti-MBP-1 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-CIRIP, Anti-HGNC:4920, Anti-MBP-1, Anti-PRDII-BF1, Anti-ZNF40
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 47 kDa
• Reattività contro le specie: human
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso NCBI: NP_002105
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• Informazioni sul gene: human ... MBP-1(3096)

Descrizione

Descrizione generale

Immunodeficiency virus type I enhancer binding protein/cirhin interaction protein/Myc promoter-binding protein-1 (HIVEP1, CIRIP, MBP-1, ZNF40, PRDII-BF1) is a transcription factor involved in the activation of HIV-1 gene expression and the repression of c-myc gene expression.

Immunogeno

Synthetic peptide directed towards the middle region of human ENO1

Applicazioni

Rabbit polyclonal anti-MBP-1 antibody is used to tag immunodeficiency virus type I enhancer binding protein/cirhin interaction protein/myc promoter-binding protein-1 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of immunodeficiency virus type I enhancer binding protein/cirhin interaction protein/myc promoter-binding protein-1 in HIV-1 and c-myc gene expression. Anti-MBP-1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.

Rabbit polyclonal anti-MBP-1 antibody reacts with human immunodeficiency virus type I enhancer binding protein/cirhin interaction protein/myc promoter-binding protein-1 transcription factor.

Azioni biochim/fisiol

MBP-1 binds to the GGGACTTTCC sequence motif found in enhancer elements of viral promoters. It regulates the transcription of both cellular and viral (HIV-1) genes.

Sequenza

Synthetic peptide located within the following region: GSGGMTHSDQPKEDRQGVNEKSCNCLLLKVNQIGSVTESLQACKLAQANG

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable