AV100621
Anti-SMAD3 antibody produced in rabbit
IgG fraction of antiserum
Sinonimo/i:
Anti-SMAD family member 3
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Codice UNSPSC:
12352203
NACRES:
NA.41
Prodotti consigliati
Origine biologica
rabbit
Livello qualitativo
Coniugato
unconjugated
Forma dell’anticorpo
IgG fraction of antiserum
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Forma fisica
buffered aqueous solution
PM
48 kDa
Reattività contro le specie
dog, rat, human, mouse, guinea pig
Concentrazione
0.5 mg - 1 mg/mL
tecniche
immunohistochemistry: suitable
western blot: suitable
N° accesso NCBI
N° accesso UniProt
applicazioni
research pathology
Condizioni di spedizione
wet ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... SMAD3(4088)
Categorie correlate
Descrizione generale
The members of Smad family of proteins are essential intracellular mediators of TGF-β signaling.
Immunogeno
Synthetic peptide directed towards the N terminal region of human SMAD3
Applicazioni
Anti-SMAD3 antibody produced in rabbit is suitable for western blotting at a concentration of 2 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.
Azioni biochim/fisiol
Smad3 is phosphorylated by TGF-b, heterodimerizes with Smad4 and enters the nucleus. The heterodimer binds within the promoter of plasminogen activator inhibitor-1 (PAI-1) and induces its expression.
Sequenza
Synthetic peptide located within the following region: FTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAIT
Stato fisico
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Non trovi il prodotto giusto?
Prova il nostro Motore di ricerca dei prodotti.
Raccomandato
N° Catalogo
Descrizione
Determinazione del prezzo
Codice della classe di stoccaggio
10 - Combustible liquids
Classe di pericolosità dell'acqua (WGK)
WGK 3
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Certificati d'analisi (COA)
Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
A Nakao et al.
The EMBO journal, 16(17), 5353-5362 (1997-10-06)
Smad family members are newly identified essential intracellular signalling components of the transforming growth factor-beta (TGF-beta) superfamily. Smad2 and Smad3 are structurally highly similar and mediate TGF-beta signals. Smad4 is distantly related to Smads 2 and 3, and forms a
L Zawel et al.
Molecular cell, 1(4), 611-617 (1998-07-14)
Mounting evidence indicates that Smad proteins are required for TGF beta signaling, but the way(s) in which Smad proteins propagate this signal is unclear. We found that two human Smad proteins (Smad3 and Smad4) could specifically recognize an identical 8
Soo Youn Cho et al.
Medical oncology (Northwood, London, England), 31(11), 236-236 (2014-10-01)
Smad3 functions as an integrator of diverse signaling, including transforming growth factor β signaling and the function of Smad3 is complexly regulated by differential phosphorylation at various sites of Smad3. Despite the importance of Smad3 and its various phosphoisoforms, their
Nicolás Tobar et al.
BMC cancer, 14, 640-640 (2014-09-02)
Hard consistency, developed under the influence of tumor cell factors, is a characteristic feature of a breast tumor. Activation of resident fibroblasts leading to a myofibroblast phenotype is the principal feature that orchestrates this fibrotic process. The aim of this
Jinyi Han et al.
Experimental biology and medicine (Maywood, N.J.), 239(3), 272-283 (2014-02-07)
All-trans retinoic acid (ATRA) has been used for the treatment of acute promyelocytic leukemia. It remains unclear, however, whether ATRA affects cyclooxygenase-2 (COX-2; an enzyme involved in prostaglandin production), PGE2, and thromboxane A2 (TXA2) (metabolic products of COX-2) by a
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.